PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof009020
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family HD-ZIP
Protein Properties Length: 275aa    MW: 30191.6 Da    PI: 8.7338
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Saccharum_officinarum-109078PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.25.9e-18108161356
                --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                k+++++ eq+++Le+ Fe  +++  e++ +LA+ lgL+ rqV +WFqNrRa++k
  Sof009020 108 KKRRLNVEQVRTLEKNFELGNKLEPERKLQLARALGLQPRQVAIWFQNRRARWK 161
                4568999**********************************************9 PP

2HD-ZIP_I/II129.21.7e-41107198192
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                  ekkrrl+ eqv++LE++Fe  +kLeperK +lar+Lglqprqva+WFqnrRAR+ktkqlEkdy+aLkr++da+k++n++L +++++L++e+ 
    Sof009020 107 EKKRRLNVEQVRTLEKNFELGNKLEPERKLQLARALGLQPRQVAIWFQNRRARWKTKQLEKDYDALKRQLDAVKADNDALLSHNKKLQAEIV 198
                  69**************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-1887164IPR009057Homeodomain-like
SuperFamilySSF466891.03E-1996165IPR009057Homeodomain-like
PROSITE profilePS5007117.346103163IPR001356Homeobox domain
SMARTSM003891.3E-17106167IPR001356Homeobox domain
PfamPF000462.4E-15108161IPR001356Homeobox domain
CDDcd000864.62E-16108164No hitNo description
PRINTSPR000311.2E-5134143IPR000047Helix-turn-helix motif
PROSITE patternPS000270138161IPR017970Homeobox, conserved site
PRINTSPR000311.2E-5143159IPR000047Helix-turn-helix motif
PfamPF021838.5E-15163202IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 275 aa     Download sequence    Send to blast
ASNGMASSPS PFFPPNFLLQ MQQTPSDHDP QEQHHHLPGA PPLHPHHNPF LPSSQCPSLQ  60
DFRGMAPMLG KRPMYGADVV VGGEEVNGGG GGANEDEMSD DGSQAGEKKR RLNVEQVRTL  120
EKNFELGNKL EPERKLQLAR ALGLQPRQVA IWFQNRRARW KTKQLEKDYD ALKRQLDAVK  180
ADNDALLSHN KKLQAEIVAL KGGRRQXSSE LINLNKETEA SCNHPQRRTA SENPPSDILA  240
ATPGGSERPP LVTPPAGPNA TQATPPTARW GWPGQ
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1155163RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sof.153150.0inflorescence| leaf| meristem| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002465782.11e-135hypothetical protein SORBIDRAFT_01g045740
SwissprotA2XD083e-97HOX21_ORYSI; Homeobox-leucine zipper protein HOX21
TrEMBLC5WVY21e-135C5WVY2_SORBI; Putative uncharacterized protein Sb01g045740
STRINGSb01g045740.11e-134(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.11e-67HD-ZIP family protein